PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_68487.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SRS
Protein Properties Length: 279aa    MW: 28991.1 Da    PI: 9.182
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_68487.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702222.21.1e-681012523154
        DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskke 99 
                   s ++sCqdCGnqakkdC+h+RCRtCCksrgf C+thvkstWvpa+krrerqqql+a++++aaa++a a + r+ +++ +++ a+++ ++ss+++++ 
  MLOC_68487.1 101 SAGTSCQDCGNQAKKDCQHQRCRTCCKSRGFACSTHVKSTWVPASKRRERQQQLTALAASAAATTAGAGPSRDPTKRPRARLAVTTPTTSSGDQQMV 197
                   56789****************************************************9999999988888888888899999*************** PP

        DUF702 100 letsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                   + ++++P+evsseavfrcvr++ vd++e+elaYqt+vsigGhvfkGiL+d G+++
  MLOC_68487.1 198 TVAERFPREVSSEAVFRCVRLGPVDQAEAELAYQTTVSIGGHVFKGILHDVGPSS 252
                   ****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.9E-64103251IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.7E-26105147IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.7E-23202250IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MAGFPLGTGG SGRDSPASPP GVHPSDASTF LYATRGGGFQ LWGQPQDQHQ HQHQLTHPFY  60
ASNLIRFATD DLPAGAAQSL AGAASSSSSR AARAAALAGG SAGTSCQDCG NQAKKDCQHQ  120
RCRTCCKSRG FACSTHVKST WVPASKRRER QQQLTALAAS AAATTAGAGP SRDPTKRPRA  180
RLAVTTPTTS SGDQQMVTVA ERFPREVSSE AVFRCVRLGP VDQAEAELAY QTTVSIGGHV  240
FKGILHDVGP SSNAHAQLQA AAGGSGSDYQ FRLTGDVSP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2412851e-157AK241285.1 Oryza sativa Japonica Group cDNA, clone: J065137A19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001130248.11e-108hypothetical protein
SwissprotQ9SD408e-50SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLM0YEK00.0M0YEK0_HORVD; Uncharacterized protein
STRINGMLOC_68487.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135435124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.18e-46Lateral root primordium (LRP) protein-related